PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G053900.1
Common NameMYB21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 333aa    MW: 37085.7 Da    PI: 5.0769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G053900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.7e-142067148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  Potri.009G053900.1 20 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 67
                        678*******************************************97 PP

2Myb_DNA-binding50.54.8e-1673116146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+e +++++ +lG++ W+ Ia++++ gRt++++k++w++
  Potri.009G053900.1  73 RGAFSPQEEEMIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 116
                         89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.931567IPR017930Myb domain
SuperFamilySSF466891.09E-2718114IPR009057Homeodomain-like
SMARTSM007171.3E-91969IPR001005SANT/Myb domain
PfamPF002493.1E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-222174IPR009057Homeodomain-like
CDDcd001674.31E-82367No hitNo description
PROSITE profilePS5129425.3868122IPR017930Myb domain
SMARTSM007171.0E-1572120IPR001005SANT/Myb domain
PfamPF002497.9E-1573116IPR001005SANT/Myb domain
CDDcd001674.04E-1175115No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2675123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MRKPEASGKN NVNNINKFRK GLWSPEEDDK LMNYMLNNGQ GCWSDVARNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE EEMIIHLHSL LGNRWSQIAA RLPGRTDNEI KNFWNSTIKK  120
RLKNLQSSNA SPNTSDSSSE PSKDVMGGLM STMQEQGIFS MNMDPSMSSS SSLATSMKAM  180
ILNTMMDPLL PMLDYDHGLN MYGGASGYES ITAPPCMAQV GVLNSGDHGF YGEGIFEGIN  240
VEIPPLESVS CMEENAKTQN IQDNNTDKYS YSSPVNSLYH KNCNITSNNK TDSIAADQMG  300
NLWHGSEELK VGEWDLEELM KDVSAFPFLD FQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27201227108B-MYB
1h8a_C2e-262012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486780.0KF148678.1 Populus trichocarpa MYB transcription factor (MYB21) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025528.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV27e-75MYB46_ARATH; Transcription factor MYB46
TrEMBLS5XGT40.0S5XGT4_POPTR; MYB transcription factor
STRINGPOPTR_0009s05860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.17e-73myb domain protein 46
Publications ? help Back to Top
  1. McCarthy RL, et al.
    The poplar MYB transcription factors, PtrMYB3 and PtrMYB20, are involved in the regulation of secondary wall biosynthesis.
    Plant Cell Physiol., 2010. 51(6): p. 1084-90
    [PMID:20427511]
  2. Zhong R,McCarthy RL,Haghighat M,Ye ZH
    The poplar MYB master switches bind to the SMRE site and activate the secondary wall biosynthetic program during wood formation.
    PLoS ONE, 2013. 8(7): p. e69219
    [PMID:23922694]